PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F01571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 333aa    MW: 36256.6 Da    PI: 4.3602
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F01571.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.92.4e-271058250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    rien++nrqvtfskRrng+ KKA+ELSvLCd++va+++fs++g+l  +s
  Pahal.F01571.1 10 RIENNINRQVTFSKRRNGLVKKAYELSVLCDIDVALLMFSPSGRLSHFS 58
                    8********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.987161IPR002100Transcription factor, MADS-box
SMARTSM004327.5E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-28277IPR002100Transcription factor, MADS-box
CDDcd002652.22E-36275No hitNo description
PRINTSPR004041.8E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRVKLPIRR IENNINRQVT FSKRRNGLVK KAYELSVLCD IDVALLMFSP SGRLSHFSGR  60
SGVEDVILRF MNLSEHDGGG AVQNRERDSV PYLVSMLQRL KREGDMATQL ANPGALNERI  120
EEIQREIYSS QQQLHIYEER LRLFEPDTAA FGSTSEIHGC EKVLADLLAR VVQRKNYLLG  180
DHMTPFDPAA SGMEGTDGAQ MYTDQAEGTF AGDAALWAAA DVGADDPGHQ MFGAADPLMY  240
LRDQDVYDAT SQVAGLHGDP CAAGGEAADA EAEAEAWRQA YTCTELLSTL IPSTPFPLMP  300
HCLGPDDEFL PLQDDGGMAA AQEPVEASES CS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-17175174Myocyte-specific enhancer factor 2B
1tqe_Q4e-17175174Myocyte-specific enhancer factor 2B
1tqe_R4e-17175174Myocyte-specific enhancer factor 2B
1tqe_S4e-17175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693351e-54KF469335.1 Brachypodium distachyon MADS-box transcription factor 41 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973793.10.0PREDICTED: agamous-like MADS-box protein AGL66 isoform X3
TrEMBLA0A0E0QKM11e-169A0A0E0QKM1_ORYRU; Uncharacterized protein
STRINGSi013985m1e-168(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.11e-67AGAMOUS-like 66